PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG026000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 270aa    MW: 27726.2 Da    PI: 9.8418
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG026000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1988142256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Pavir.4KG026000.1.p  88 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTK 142
                          788899***********************************************98 PP

2HD-ZIP_I/II126.61.1e-4088177191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL kev+eLr +
  Pavir.4KG026000.1.p  88 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCEQLAEENRRLGKEVAELR-A 176
                          69*************************************************************************************9.4 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Pavir.4KG026000.1.p 177 L 177
                          4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-1972138IPR009057Homeodomain-like
PROSITE profilePS5007116.60184144IPR001356Homeobox domain
SMARTSM003893.8E-1786148IPR001356Homeobox domain
SuperFamilySSF466892.51E-1887153IPR009057Homeodomain-like
CDDcd000861.77E-1588145No hitNo description
PfamPF000466.7E-1788142IPR001356Homeobox domain
PRINTSPR000311.5E-5115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000311.5E-5124140IPR000047Helix-turn-helix motif
PfamPF021831.0E-10144177IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-20144187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAPQSLDLGL SLGLGLAALQ PSFCYSGNAA AAEREASPAA AEERERRCSP AGSPVSSGSG  60
SGGKRAAAER SAGAGAGSGD EGDDGAARKK LRLSKDQAAV LEECFKTHHT LTPKQKVALA  120
SSLGLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRWCEQL AEENRRLGKE VAELRALNAA  180
AAAPAPAPPL TTLTMCLSCR RVASSSSPSN ASSIPATHAH AAANAGAGMA SPAAATLPGH  240
RQFFCGFRDA GAAAYGTSSG LAKALKAAR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.317881e-174root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9681200.0EU968120.1 Zea mays clone 314746 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964495.11e-115PREDICTED: homeobox-leucine zipper protein HOX28-like
SwissprotA2Y9313e-72HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE53e-72HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLK3XYS41e-115K3XYS4_SETIT; Uncharacterized protein
STRINGSi007082m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.14e-49homeobox-leucine zipper protein 4